PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009619961.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 532aa    MW: 57475.3 Da    PI: 7.4727
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009619961.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.62.6e-33240296259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     dDgynWrKYGqK+vkgse+prsYY+Ct+++Cpv+kkvers  d++v+ei+Y+g+Hnh+
  XP_009619961.1 240 DDGYNWRKYGQKHVKGSEYPRSYYKCTHPNCPVRKKVERSL-DGQVTEIIYKGQHNHH 296
                     8****************************************.***************7 PP

2WRKY106.61.3e-33419477159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Cts+gC+v+k+ver+ +dpk+v++tYeg+Hnh+
  XP_009619961.1 419 LDDGYRWRKYGQKVVKGNPYPRSYYKCTSQGCNVRKHVERAPSDPKAVITTYEGKHNHD 477
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.6E-30232298IPR003657WRKY domain
PROSITE profilePS5081124.398234298IPR003657WRKY domain
SuperFamilySSF1182904.05E-26238298IPR003657WRKY domain
SMARTSM007742.5E-37239297IPR003657WRKY domain
PfamPF031061.7E-25240296IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-37405479IPR003657WRKY domain
SuperFamilySSF1182907.32E-30411479IPR003657WRKY domain
PROSITE profilePS5081139.054414479IPR003657WRKY domain
SMARTSM007743.9E-40419478IPR003657WRKY domain
PfamPF031062.7E-26420477IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:1900150Biological Processregulation of defense response to fungus
GO:1900425Biological Processnegative regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MAENEASSSS ASSSRAPMRP TITLPPRASV ENLFMGGLGG ISPGPMTLVS SFFSDPASEY  60
PSFSQLLAGA MASPAAFSGQ RQGFPPPPET TVSISKGKES GSGDMDFGFK QNRPSGLVIT  120
QSPMFTIPPG LSPAGLLGSP LLFSPGQGPF GMSHQQALAQ VTAQAAHPQS QMHIQPDYPS  180
SSAPPARSFS QFQSLTSNTT ANQQIPPPAS DPNVMKEASE VSLSDQRSEP ASSAVDKPAD  240
DGYNWRKYGQ KHVKGSEYPR SYYKCTHPNC PVRKKVERSL DGQVTEIIYK GQHNHHPPQS  300
SKRSKESGNP NGNYNLQGPS ELSSEGVAGT LNNSKDGMPS YSLRMKDQES SQATHDQVSG  360
SSEGEEVGDA ETIADGNDER ESKRRAIEVQ TSEAASSASH RTVAEPRIIV QTTSEVDLLD  420
DGYRWRKYGQ KVVKGNPYPR SYYKCTSQGC NVRKHVERAP SDPKAVITTY EGKHNHDVPA  480
ARNSSHNTAN NSVSQMRPHN PVVDKQEATR TGFPNNEQQP IALLRFKEEQ VT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-41240480878Probable WRKY transcription factor 4
2lex_A1e-41240480878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0962990.0AF096299.1 Nicotiana tabacum DNA-binding protein 2 (WRKY2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619961.10.0PREDICTED: probable WRKY transcription factor 4
SwissprotQ9XI901e-174WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLQ9ZPL60.0Q9ZPL6_TOBAC; DNA-binding protein 2
STRINGPGSC0003DMT4000728360.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41072445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-146WRKY DNA-binding protein 4